Protein Info for CCNA_03112 in Caulobacter crescentus NA1000

Annotation: magnesium and cobalt efflux protein corB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 61 to 80 (20 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details PF01595: CNNM" amino acids 11 to 190 (180 residues), 158.8 bits, see alignment E=1.8e-50 PF00571: CBS" amino acids 206 to 264 (59 residues), 25.7 bits, see alignment E=1.8e-09 amino acids 280 to 329 (50 residues), 27.9 bits, see alignment 3.5e-10 PF03471: CorC_HlyC" amino acids 345 to 419 (75 residues), 64 bits, see alignment E=1.5e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03112)

Predicted SEED Role

"Co2 transporter containing CBS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDZ1 at UniProt or InterPro

Protein Sequence (428 amino acids)

>CCNA_03112 magnesium and cobalt efflux protein corB (Caulobacter crescentus NA1000)
MLTALLGLAPIVIALLTLSAIFSAAETSMTGASRARMHQLEREGDRPAKRVNKLLSDQET
MIGAVLLGNNLINILASALATQVLTTLIPGPWGVAVATAAMTVLILIFAEVLPKTLAIVR
SDDVARALSAPTLFIVRLFGPIIYAIQWIVRRTLRVFGVKLDMAVDVLAAHEEIRGAVDY
HHSEGLVETDDRRMLGGVLDLSDMDVSEIMVHRKSMVLLDAGLPARELVDAVLEAQHTRI
PLYRDQPDNIVGVLHARDLLKALAECPTGVEGLDIAAILREPWFIPDATNLKDQLNAFLK
RKNHFALVVDEYGALQGLVTLEDILEEIVGEIEDEHDTTLDGVRRQGDGSVNVDGHVTVR
DLNRAMDWRLPEGEAVTIAGLVIHEAQMIPEPGQTFIFYRHRFQVLRRQRNQITALRISA
RLDDDSDA