Protein Info for CCNA_03105 in Caulobacter crescentus NA1000

Annotation: DnaJ domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00226: DnaJ" amino acids 163 to 212 (50 residues), 38.8 bits, see alignment E=4.2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03105)

Predicted SEED Role

"FIG003437: hypothetical with DnaJ-like domain" in subsystem Conenzyme B12 related Hypothetical: Clusters with cobST

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDY5 at UniProt or InterPro

Protein Sequence (216 amino acids)

>CCNA_03105 DnaJ domain protein (Caulobacter crescentus NA1000)
MNRPFEYRPKFYDIRVRPPKEGEEDPAHDVLGLKPGEKRCDHPDCRLAGSAKAPKSRDMP
GDHYWFCQRHAAEYNKNWNFYAGMSEAQIRAEQESERMTGGRPTWSFKADANSREAAAMA
ARDARHFADPFGVFRAQQRRAEAERSAAERRLGKLERQALADLDLEATADSAAIRARYKE
LLKRCHPDANGGDRSAEHKLQRVIKAYKQLQKSGMV