Protein Info for CCNA_03097 in Caulobacter crescentus NA1000

Annotation: aldo/keto reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF00248: Aldo_ket_red" amino acids 15 to 312 (298 residues), 244.1 bits, see alignment E=8.6e-77

Best Hits

Swiss-Prot: 51% identical to AKR2_ORYSI: Probable aldo-keto reductase 2 (OsI_15387) from Oryza sativa subsp. indica

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03097)

Predicted SEED Role

"Aldo-keto reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCD3 at UniProt or InterPro

Protein Sequence (333 amino acids)

>CCNA_03097 aldo/keto reductase family protein (Caulobacter crescentus NA1000)
MKTRELGDGLKVSAIGLGCMGMGQVYGTALETGDAFKLMARAVELGVTFFDTAEVYGPFA
NEELVGQGLKPFRDQVVIATKFGFDIGPEDLGQGMARVRGVNSRPEHIRSVAEASLKRLG
IETIDLFYQHRVDPAVPIEDVAGTVKDLIAEGKVKHFGLSEAGAATIRKAHAIQPVAALQ
SEYSLWFRELEAEILPTLRELKIGLVPYSPLGRGFLAGAVKAETMGEGDFRKGLPRFQGE
ALQKNLSLVEALSAIAADKGVTPAQLALAWILHQGHDIAPIPGTTKIHRLEENVAAVDVT
FSADELARIAAAVPETEIEGERYSKTGMAMVGR