Protein Info for CCNA_03085 in Caulobacter crescentus NA1000

Annotation: nitropropane dioxygenase/trans-enoyl-CoA reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF00478: IMPDH" amino acids 2 to 215 (214 residues), 35.2 bits, see alignment E=7.5e-13 PF03060: NMO" amino acids 5 to 310 (306 residues), 191.1 bits, see alignment E=3.5e-60

Best Hits

Swiss-Prot: 68% identical to NQRED_PSEAE: NADH:quinone reductase (PA1024) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00459, nitronate monooxygenase [EC: 1.13.12.16] (inferred from 100% identity to ccs:CCNA_03085)

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.9

Use Curated BLAST to search for 1.13.12.16 or 1.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC85 at UniProt or InterPro

Protein Sequence (325 amino acids)

>CCNA_03085 nitropropane dioxygenase/trans-enoyl-CoA reductase family (Caulobacter crescentus NA1000)
MAIKTRFTELFGVEHPIAQGGMQWVGKAELVSAVANAGALGFLTALTQPTPEALSKEIAR
TREMTDKPFGVNLTILPAMTPPPYAEYRAAIIESGIKIVETAGYKPQEHVDHFKANGVKV
IHKCTAVRHALSAERMGVDAISIDGFECAGHPGEDDIPGLILIAAAADKVKIPMLASGGI
ADARGLVAALALGADGVNMGTRFCVTQEAPIPMAFKEQMVANDERQTDLIFRTLHNTARV
MRNAVSQEVVQIERAGGAKFEDVAHLVAGTRGRDALAQGDTDGGIWSAGMVQGLIHDIPT
VKDLVDRMVAEAEDLIRGRLARMLG