Protein Info for CCNA_03054 in Caulobacter crescentus NA1000

Annotation: AraC-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 5 to 170 (166 residues), 69.5 bits, see alignment E=4.6e-23 PF00165: HTH_AraC" amino acids 218 to 254 (37 residues), 36.6 bits, see alignment 5.8e-13 PF12833: HTH_18" amino acids 230 to 308 (79 residues), 80.9 bits, see alignment E=1e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2960)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC52 at UniProt or InterPro

Protein Sequence (312 amino acids)

>CCNA_03054 AraC-family transcriptional regulator (Caulobacter crescentus NA1000)
MSRAIGFLVYPGFQLLDATGPIAAFEIAGRLAPGAYSLHFLSLRGGLIPSTSGMVVQTKA
LAEAPPLDTLLIAGGDAVKVPASCPETLAFVRQAGRSARRVASVCSGTYVLAEAGLLDGK
RATTHWSRTKDFQRRYPHVRLEPDRIWIQDGAVWSSAGITAGIDLSLALIGADEGEAVAR
RTAQQLVVYHHRPGGQSQHSALIDLRPGRFDGLLSWARQNLSEPLSVEQLADRAAMSPRN
FARLFAQETGVTPAKAIERLRVEAARALLDSQPLQVEDVALETGFGDPERMRRAFIRAFG
QPPQALRRARAG