Protein Info for CCNA_03049 in Caulobacter crescentus NA1000

Annotation: transporter, MFS superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 54 to 72 (19 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details amino acids 429 to 452 (24 residues), see Phobius details amino acids 459 to 481 (23 residues), see Phobius details PF11700: ATG22" amino acids 221 to 481 (261 residues), 71.1 bits, see alignment E=8.4e-24

Best Hits

KEGG orthology group: K06902, MFS transporter, UMF1 family (inferred from 100% identity to ccs:CCNA_03049)

Predicted SEED Role

"FIG00481966: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CB96 at UniProt or InterPro

Protein Sequence (488 amino acids)

>CCNA_03049 transporter, MFS superfamily (Caulobacter crescentus NA1000)
MGVWGMSELAGTPPGLSDVAGAEGREDVLVPPPTGKLSKGALSWILHQGTRDPYVILVTI
YVFAPYFSRVLIGDPVKGQATVADISTTYGLLTALLAPILGASIERYGPRKPLMALGLAI
MVPLLFGLWWATPGGLPVGLIGVFLIILGVVYNCGDVLQNSLLSRAAEKGQEPVLSGLGY
ATANGLSVALLIFVMWAFVLPGQVSWSFVPAGPLFGLSQADHEPSRIVGPLAAVVMLLGA
IPFFLWTRDAPRTGLPFAAALKEGFKLLIDTFGNLKGHADVAKFLGARMLYCDGMTALLI
FGGLFAAGLMQWGELEMLAYGISLSIFGVLGGLIAPWLDRVLGPRRAIQLEVGMCILILI
AMLGMTREQILYVWPWDASQGVLWNGPIFRTLPEVIYLGLGLLIAVFVTAQYASSRTLLV
RLAPPDRMAAFFGLFSLSGTATMWVGSLLVALATKVFASQVAGFIPIAVLLALGLLGLFT
VKGGGREG