Protein Info for CCNA_03036 in Caulobacter crescentus NA1000

Annotation: TadB-related pilus assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details PF00482: T2SSF" amino acids 161 to 282 (122 residues), 74 bits, see alignment E=5.6e-25

Best Hits

KEGG orthology group: K12510, tight adherence protein B (inferred from 100% identity to ccr:CC_2941)

Predicted SEED Role

"Flp pilus assembly protein TadB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC65 at UniProt or InterPro

Protein Sequence (325 amino acids)

>CCNA_03036 TadB-related pilus assembly protein (Caulobacter crescentus NA1000)
MLFVLAGILGFITIAGLGFAFAGGDSASSKAAKRAQIIAKGGERQANVRAKAAANTPDAR
RQAILKALKDQDRKQKKASLSIAARLQAAGLGDNVKMFWIVSGTLGLFIAMIILLLGQSP
LVALGAGFAAGAGLPRWVLGFLAKGRTQKFTEAFADAVDIIVRGIKSGLPVHDCLKIIGK
ECPEPLAGEFRILTENVAMGVPMDAALEKMYERMPTNELRFFAIVLAIQQKTGGNLAEAL
GNLSAVLRSRKLMKEKIKALSAEAVASAFIIGCLPPGVVTLISVTSPAYMAPMFTDPRGH
LMLLASAIWMSIGIFVMRNMINFKF