Protein Info for CCNA_03017 in Caulobacter crescentus NA1000

Annotation: hydrogenase, cytochrome b-type subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 114 to 132 (19 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 109 to 306 (198 residues), 85.7 bits, see alignment E=1.8e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03017)

Predicted SEED Role

"Cytochrome b (EC 1.10.2.2)" (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDP8 at UniProt or InterPro

Protein Sequence (308 amino acids)

>CCNA_03017 hydrogenase, cytochrome b-type subunit (Caulobacter crescentus NA1000)
MGPSLSLRERGFRGVRSGSKAAFTPPPETRPSRRHARAAKPMPGRSGFWAVRPAPRGQRR
KHQLTPGRVSRAPMAAGRRTAQGLSPLKPGEAPMTAPAAPLETAPPPRRWDPVVKLTHWT
IVGAILANGLITEEGSTPHVWVGYALAATLALRLIWGVIGPAEARFAAFPPSPARALAHL
REIAQGRRSQHASHNPLGALMVYAIWSTLAVIVVTGVLMANAPAEPKDLVAAPPAAVHSE
ARESDEIGEEAEAQEGAEGHGEEGPLAEVHETAVNLLYVLIVLHIAGVVFETRRSGRRIV
LAMLPGRR