Protein Info for CCNA_03007 in Caulobacter crescentus NA1000

Annotation: L-aspartate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00890: FAD_binding_2" amino acids 12 to 382 (371 residues), 297.5 bits, see alignment E=3e-92 PF02910: Succ_DH_flav_C" amino acids 460 to 489 (30 residues), 29.9 bits, see alignment (E = 7.5e-11)

Best Hits

Swiss-Prot: 100% identical to NADB_CAUVC: L-aspartate oxidase (nadB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00278, L-aspartate oxidase [EC: 1.4.3.16] (inferred from 100% identity to ccs:CCNA_03007)

Predicted SEED Role

"L-aspartate oxidase (EC 1.4.3.16)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 1.4.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDN6 at UniProt or InterPro

Protein Sequence (511 amino acids)

>CCNA_03007 L-aspartate oxidase (Caulobacter crescentus NA1000)
MTQYRITFEGPVILGAGLAGLTAALSATTGAAKTALVLSPTPLASGCSSAWAQGGMAAAL
SGDDSPALHAADTIAAGAGLCDPQAVDLLTREGPQAVRDLAALGAPFDRKADDGFVLSLE
AAHSAARVARVGGDGAGAAIMAAVIAAVRATPGIEVRENARARRLLQDANGRVVGVLADV
DGALVEIRSTAVILATGGVGGLYAVTTTPAQVRGEGLGLAALAGAMIADPEFVQFHPTAI
DIGRDPAPLATEALRGEGAILRNADGKAFMADYHPAKELAPRDVVARALHAERAAGRGAF
LDATAAVGAHFPHEFPAVFEACMSAGIDPRRQMIPVTPAVHYHMGGVATDLDGRASLPGL
YAAGECASTGVQGANRLASNSLLEAAVFGARAGRAAAAEGATGGPPVSLEPLPDLPDAAL
QGLRKAMSRDAGVIRDADGLTRLLGEIETLEAGHGQGPILVAARLIVTAALAREESRGGH
CRIDFPATDPVGVRTFVTLDGREPGLRYAAE