Protein Info for CCNA_03006 in Caulobacter crescentus NA1000

Annotation: quinolinate synthetase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 48 to 344 (297 residues), 316.6 bits, see alignment E=8.4e-99 PF02445: NadA" amino acids 49 to 342 (294 residues), 370.8 bits, see alignment E=2.3e-115

Best Hits

Swiss-Prot: 100% identical to NADA_CAUVN: Quinolinate synthase A (nadA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 100% identity to ccr:CC_2912)

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H2F3 at UniProt or InterPro

Protein Sequence (367 amino acids)

>CCNA_03006 quinolinate synthetase A (Caulobacter crescentus NA1000)
MADGFATAPQDFKGVFTPEIEAQTAPVWEKVKHHVTPMEWRVQAPLIVEINRLKREKNAA
ILAHNYMTPDIFHGVGDFVGDSLALAKEAAKSDAQIIVQAGVHFMAETSKVLSPEKKILI
PDLKAGCSLASSITGADVRLIKQRYPGVPVVTYVNTTADVKAETDICCTSANAVQVVEWA
AKEWGTDKVILIPDEFLARNVARQTDVKIIAWAGHCEVHKRFTAQDIADMRAAWPGAEVL
AHPECPAEILEAADFAGSTAAMNDYVAAKKPAQVVLITECSMASNVQAESPATQFIGPCN
MCPHMKRITLQNIYDALVHEQYEVTVDAEVLDRARLAVQRMIDLPPPAVPARYDLVKARH
HVDVELI