Protein Info for CCNA_03002 in Caulobacter crescentus NA1000

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 48 to 66 (19 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 170 to 196 (27 residues), see Phobius details TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase" amino acids 3 to 204 (202 residues), 128 bits, see alignment E=3.1e-41 PF01066: CDP-OH_P_transf" amino acids 4 to 190 (187 residues), 100.9 bits, see alignment E=4.6e-33

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 100% identity to ccr:CC_2908)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAH8 at UniProt or InterPro

Protein Sequence (205 amino acids)

>CCNA_03002 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Caulobacter crescentus NA1000)
MKALPNILTSSRLVMALFMFIALAAAAGAVPYVSEQLTAETQFRLERWAFYAFVVAAVTD
FVDGWLARKLDAVSVWGAILDPIGDKILVCGALLGLMALGPNPMVVLPAGLILFREFTVS
ALREVGAGKGVKLPVTLLAKWKTTLQLVAIGAEMILASWSAFGLPPEPALVGGFTLIAHG
LLWLATVVTLVTGAQYWEAARKALV