Protein Info for CCNA_02975 in Caulobacter crescentus NA1000

Annotation: excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 TIGR00194: excinuclease ABC subunit C" amino acids 27 to 618 (592 residues), 546.2 bits, see alignment E=5e-168 PF01541: GIY-YIG" amino acids 37 to 110 (74 residues), 33.7 bits, see alignment E=7.3e-12 PF02151: UVR" amino acids 226 to 257 (32 residues), 35.6 bits, see alignment (E = 1.2e-12) PF08459: UvrC_RNaseH_dom" amino acids 410 to 571 (162 residues), 175.7 bits, see alignment E=1.3e-55 PF14520: HHH_5" amino acids 587 to 633 (47 residues), 32.1 bits, see alignment 2.6e-11

Best Hits

Swiss-Prot: 100% identical to UVRC_CAUVC: UvrABC system protein C (uvrC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to ccr:CC_2881)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAF6 at UniProt or InterPro

Protein Sequence (640 amino acids)

>CCNA_02975 excinuclease ABC subunit C (Caulobacter crescentus NA1000)
MTDTPSASDAEAPLRQAAPLWGAALIKDEVTRLPDAPGVYRMIGEADEVLYVGKAKSLKK
RVVQYAQGRFHTNRIANMVDATRAMEFITTRTEADALLLEINLIKQLKPRFNVLLRDDKS
FPEIVIRRDHDAPQLRKHRGAHTIKGDYFGPFASAWAVNRTLNTLQKAFLLRSCSDSVYD
SRDRPCMLYQIKRCAAPCTGLIGKDDYQALVDQAEAFLRGKSRAVMATMAKAMEEAAEEL
EFERAARLRDRIRALSAVAQETQINPETVEEADVVALHVEGGQACVQVFFFRAGQNWGNR
AYFPRITGAADDPEDETVTEEQRIITAFLGQFYDDKPIPRLILANVQPAESELLSEAFAL
KSGRKVEIAVPKRGEKADLVQHVLTNAREALGRKMAEGSAQTKLLAGVAEAFKLDAPPER
IEVYDNSHIQGANAVGGMIVAGPEGFMKGQYRKFNIKSTELTPGDDYGMMKEVLRRRFAR
LVKEEEEGDDANRPDLVLVDGGQGQLDAAIEIMADLGVDDIAVVGVAKGPDRDAGLERFF
IPGQTPFMLEPKSPVLYYLQRLRDEAHRFAIGAHRTRRSMDLKKNPLDEIEGVGPGRKKA
LLHAFGSAKGVGRASVEDLVKVDGVSQALAERIFGFFRKG