Protein Info for CCNA_02964 in Caulobacter crescentus NA1000

Annotation: thioredoxin-disulfide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF07992: Pyr_redox_2" amino acids 10 to 301 (292 residues), 183.3 bits, see alignment E=2.2e-57 TIGR01292: thioredoxin-disulfide reductase" amino acids 10 to 312 (303 residues), 405 bits, see alignment E=7e-126 PF13738: Pyr_redox_3" amino acids 87 to 284 (198 residues), 64.8 bits, see alignment E=2.4e-21 PF00070: Pyr_redox" amino acids 152 to 216 (65 residues), 55.8 bits, see alignment E=1.6e-18

Best Hits

Swiss-Prot: 66% identical to TRXB_RICCN: Thioredoxin reductase (trxB) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 100% identity to ccs:CCNA_02964)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAF0 at UniProt or InterPro

Protein Sequence (335 amino acids)

>CCNA_02964 thioredoxin-disulfide reductase (Caulobacter crescentus NA1000)
MSTLSPRQTRCLIIGSGPAGYTAAIYAARALLKPVLIAGIQPGGQLTITTDVENYPGFAD
VIQGPWLMDQMRAQAEHVGTEFVSDIVTSVDLSKRPFTVKTDSGQDWIAETIIIATGAQA
KWLGLESEAKFQGFGVSACATCDGFFYRNKDVIVVGGGNTAVEEALFLTSFASKVTLVHR
KDELRAEKILQERLLAHPKIEVIWDSVIDEVLGQTDPMGVTGARLKNVKTGETQEVAADG
VFIAIGHAPSSELFAGQLETGSGGYLKVKPGTASTAIEGVYAAGDVTDDVYRQAVTAAGM
GCMAALEAVRFLAEEDHKAAHHPISHAEANKIGVW