Protein Info for CCNA_02956 in Caulobacter crescentus NA1000

Annotation: rhodanese-related sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 transmembrane" amino acids 121 to 142 (22 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details PF00581: Rhodanese" amino acids 10 to 100 (91 residues), 52.4 bits, see alignment E=6.2e-18 PF11127: YgaP-like_TM" amino acids 117 to 168 (52 residues), 31.2 bits, see alignment E=1.9e-11

Best Hits

Swiss-Prot: 51% identical to YGAP_ECOLI: Inner membrane protein YgaP (ygaP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02956)

MetaCyc: 51% identical to thiosulfate sulfurtransferase YgaP (Escherichia coli K-12 substr. MG1655)
Thiosulfate sulfurtransferase. [EC: 2.8.1.1]

Predicted SEED Role

"Rhodanese-related sulfurtransferases"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBY0 at UniProt or InterPro

Protein Sequence (178 amino acids)

>CCNA_02956 rhodanese-related sulfurtransferase (Caulobacter crescentus NA1000)
MTPQTTTPLTPDDAAQRLADGRAVLVDIREPDEFARRRARGALSRPLSTLESQGLGLPDA
REVIFTCRTGMRTGANGQRLAQVCGGRAYVVEGGLDAWDAAGLPVDHNAKAPLEMMRQVQ
IGAGVLVLIGVVLGLLVSPLFFGLAGFVGAGLTFAGVTGFCGMARLLALAPWNRPAVA