Protein Info for CCNA_02936 in Caulobacter crescentus NA1000

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF02798: GST_N" amino acids 3 to 73 (71 residues), 56.8 bits, see alignment E=7.1e-19 PF13417: GST_N_3" amino acids 11 to 79 (69 residues), 47.5 bits, see alignment E=5.5e-16 PF13409: GST_N_2" amino acids 12 to 73 (62 residues), 54.5 bits, see alignment E=4.6e-18 PF14497: GST_C_3" amino acids 135 to 206 (72 residues), 28.3 bits, see alignment E=5.3e-10 PF00043: GST_C" amino acids 142 to 205 (64 residues), 34.2 bits, see alignment E=7.5e-12 PF13410: GST_C_2" amino acids 145 to 200 (56 residues), 26.2 bits, see alignment E=2.2e-09

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 100% identity to ccr:CC_2843)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAC6 at UniProt or InterPro

Protein Sequence (220 amino acids)

>CCNA_02936 glutathione S-transferase (Caulobacter crescentus NA1000)
MIIVHHLNNSRSQRVLWLLEELGLPYEIKRYQRDAKTMLAPPELRAIHPLGKSPVITDGD
TVLAETGAIVEYIIAMYGGGRLTPTAGTPERLRYTYWLHYAEGSAMPPLLMKLVFTALPA
RAPGLMRGVVKSIAARALKGFVDPQLKAHMDYWEAELAKSTWFAGAELTGADIMMSFPLE
TAAQRAGAAERPRIKAFLERIHARPAYQRALQRGGPYDYA