Protein Info for CCNA_02903 in Caulobacter crescentus NA1000

Annotation: bifunctional D-altronate/D-mannonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF02746: MR_MLE_N" amino acids 12 to 111 (100 residues), 108.4 bits, see alignment E=2.7e-35 PF13378: MR_MLE_C" amino acids 135 to 378 (244 residues), 162.9 bits, see alignment E=9.2e-52

Best Hits

Swiss-Prot: 100% identical to MAND1_CAUVC: D-mannonate dehydratase CC2812 (CC_2812) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K08323, starvation sensing protein RspA (inferred from 100% identity to ccr:CC_2812)

Predicted SEED Role

"Starvation sensing protein RspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA96 at UniProt or InterPro

Protein Sequence (403 amino acids)

>CCNA_02903 bifunctional D-altronate/D-mannonate dehydratase (Caulobacter crescentus NA1000)
MPKIIAAKTIVTCPGRNFVTLKIMTDEGVYGLGDATLNGRELAVEAYLTQHVIPCLIGRD
AHQIEDIWQYLYRGCYWRRGPVTMAAIAAVDTALWDIKGKIAGLPVYQLLGGACRVGVMV
YGHANGETIDETLDNAAVYAQQGYKAIRLQTGVPGMSGTYGVSKDKFFYEPADSDLPKET
IWSTERYLRSTPALFEAARERLGDDLHLLHDVHHRLTPIEAARLGKDLEPYRLFWMEDAT
PAENQASFRLIRQHTTTPLAVGEIFNSIWDCKQLIEEQLIDYIRATVVHAGGITHLKKLA
SFADLHHVRTGCHGATDLSPVCMGAALHFDLSIPNFGVQEYMRHTPETDAVFPHAYTFKD
GMLHPGDAPGLGVDIDEDLAAKYPYQRAYLPIARRLDGSMHDW