Protein Info for CCNA_02901 in Caulobacter crescentus NA1000

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 TIGR00229: PAS domain S-box protein" amino acids 32 to 148 (117 residues), 42.3 bits, see alignment E=3.7e-15 PF08448: PAS_4" amino acids 43 to 148 (106 residues), 38.3 bits, see alignment E=3.4e-13 PF13426: PAS_9" amino acids 44 to 146 (103 residues), 38.9 bits, see alignment E=2.2e-13 PF00989: PAS" amino acids 45 to 144 (100 residues), 31.5 bits, see alignment E=3.8e-11 PF08447: PAS_3" amino acids 55 to 138 (84 residues), 30.2 bits, see alignment E=1.1e-10 PF00015: MCPsignal" amino acids 279 to 430 (152 residues), 65.4 bits, see alignment E=1.5e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02901)

Predicted SEED Role

"FIG00483968: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBT3 at UniProt or InterPro

Protein Sequence (503 amino acids)

>CCNA_02901 methyl-accepting chemotaxis protein (Caulobacter crescentus NA1000)
MRARRASGGLGDMWFKEIARRRRAETRRLKELESLAKAMERSQAVLELRPNATVVRANGA
FQRLTGYASPEIVGCPHSLFLAEGETDSDEYREFWRALHRGEPITKTTQLFGKEGAIVRV
RAAYSPVLDTAGKLKRVILFATDVSELKIEVVRPVIAPGRTDDQDQVITVLSEQFKALAA
GDLTARVDVVFSERYGHVRDEFNAAMTKLGQVMDEISMAAGGLGESSDEVARVSQHLSRG
AGRQALDLHGARAALQKVGAAAGRGVDGLRRVTEAAAGLRIDAASARRSVREAVGSIAEV
EQSALRISQAAALFDEVAQQANVLSLIADVEGARGGEGAGPFQAVAADKMRVLAERASGA
AREIKGVTAANSAQVSRCARLMDAASASFGGMASRITQIDGLVSGLAKSAQEQAHGLRAV
DEAVDRADDIAQTHADQVDEAAAVTGRLIEEAESLIQAASPFRAHVVSRPASRPEPARAG
HHAPAGNAVARAHARIAAYARPR