Protein Info for CCNA_02900 in Caulobacter crescentus NA1000

Annotation: N-acyl-L-amino acid amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01891: amidohydrolase" amino acids 47 to 394 (348 residues), 260 bits, see alignment E=1.9e-81 PF01546: Peptidase_M20" amino acids 100 to 396 (297 residues), 85.7 bits, see alignment E=4.3e-28 PF07687: M20_dimer" amino acids 223 to 316 (94 residues), 44 bits, see alignment E=1.9e-15

Best Hits

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 100% identity to ccs:CCNA_02900)

Predicted SEED Role

"N-acetyl-L,L-diaminopimelate deacetylase (EC 3.5.1.47)" in subsystem Lysine Biosynthesis DAP Pathway (EC 3.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.32 or 3.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBR1 at UniProt or InterPro

Protein Sequence (437 amino acids)

>CCNA_02900 N-acyl-L-amino acid amidohydrolase (Caulobacter crescentus NA1000)
MKSLFAASALALLIATAAQAGPLNVPATQKVISAQLDRDYPALEALYKDIHAHPELGFQE
VETAKKLAAQMRALGFTVTEGVGKTGVVAVLKNGEGPKVLIRTELDGLPMQEKSGLAWAS
QATATWNGEKVFVAHACGHDIHMAAWVGAARQLVAMKAKWKGTLVFVAQPSEETVRGARA
MLDDGLWDKIGGKPDYGFALHVGSGPAGEVYYKAGVLTSTSDGLDITFNGRGGHGSMPSA
TIDPVLMAARFTVDVQSVISREKDPSAFGVVTVGSIQAGSAGNIIPDKARVRGTIRTQDN
AVREKILDGVRRTVKAVTDMAGAPPADLKLTPGGKMVVNDAALTDRTAVVFKAAFGARAV
AQDKPGSASEDYSEFVLAGVPSVYFAIGGSDPAELAKAKAEGREPPVNHSPYFAPVAEPT
IRTGVEAMTLAVLNVLK