Protein Info for CCNA_02898 in Caulobacter crescentus NA1000

Annotation: tryptophan halogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01266: DAO" amino acids 8 to 221 (214 residues), 35.9 bits, see alignment E=1.3e-12 PF04820: Trp_halogenase" amino acids 8 to 464 (457 residues), 673 bits, see alignment E=4.6e-206

Best Hits

KEGG orthology group: K14266, FADH2 O2-dependent halogenase I [EC: 1.14.14.7] (inferred from 100% identity to ccs:CCNA_02898)

Predicted SEED Role

"Tryptophan halogenase"

Isozymes

Compare fitness of predicted isozymes for: 1.14.14.7

Use Curated BLAST to search for 1.14.14.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA91 at UniProt or InterPro

Protein Sequence (509 amino acids)

>CCNA_02898 tryptophan halogenase (Caulobacter crescentus NA1000)
MTSAPIRDVLIVGGGTAGWMTAAALAKALPKTIAVTLVESEQIGTVGVGEATIPPINTFN
QVLGLDEAAFMRATKGSFKLAIEFVDWMGPGHRYLHPFGGFGLDIEALKFHQVWLRAHHE
GWAPPIDAFNLSAQAAHLNRFAPPSKDPGQVLSSLKYAFHFDAGLYAKFLRDYAEPRGVT
RVEGKVAGVQQHGETGFVTGVTLEDGRVLEADLFVDCSGFRGLLIEQTLQAGYDDWSHWL
PNDRAVAMPCVTGGDGLTPYTRATADAAGWRWRIPLQHRTGNGYVYSSRDISDEDAVARL
RATLDGEPLAEPNFLRFQAGRRKAAWVKNVVAIGLSSGFLEPLESTSIHLIQAGITKLLA
LFPDRGFDPVEIAEYNRLTALQVELIRDFIILHFKANARSEPYWVRARQMDIPETLQRKI
DLFAASGRLFPSDLDLFAEPSWIAVLLGQGITPRRHDPLVDAFDEAFLKSQLSRLAGLIR
QTAQALPTHEQFIARYCAAPHASRPEFKP