Protein Info for CCNA_02887 in Caulobacter crescentus NA1000

Annotation: hydrolase/acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR03611: pyrimidine utilization protein D" amino acids 12 to 268 (257 residues), 422 bits, see alignment E=4e-131 PF12146: Hydrolase_4" amino acids 24 to 241 (218 residues), 61.4 bits, see alignment E=1.7e-20 PF00561: Abhydrolase_1" amino acids 26 to 144 (119 residues), 88.5 bits, see alignment E=1.1e-28 PF12697: Abhydrolase_6" amino acids 27 to 261 (235 residues), 51.9 bits, see alignment E=3.4e-17 PF03096: Ndr" amino acids 39 to 127 (89 residues), 24.1 bits, see alignment E=2.9e-09

Best Hits

Swiss-Prot: 100% identical to RUTD_CAUVN: Putative aminoacrylate hydrolase RutD (rutD) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K09023, protein RutD (inferred from 100% identity to ccr:CC_2797)

Predicted SEED Role

"Possible hydrolase or acyltransferase RutD in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H1Q3 at UniProt or InterPro

Protein Sequence (269 amino acids)

>CCNA_02887 hydrolase/acyltransferase family protein (Caulobacter crescentus NA1000)
MRRMTIGTVDGLHYELHGGPIAGREVVLLSSGLGGSGAFWAPQMQALTQRWPVVTYDHRG
TGRSVRELPPRYTLAHMADDMVKVMDALGLAKAHVVGHAAGGNAGLQLALDHPDRLAKLV
VVNGWSRPDPHIRRCFDTRLHLLNDTGPEAYVHAQPIFLYPADWISRNHTRLMAEEAHHV
AAFPPREVMLARINALLAFDIDARLEDITHRVLISASADDMLVPMSCSQRLAGRLPNADF
QQVAWGGHGFTVTDPETFNEALVSFLEGA