Protein Info for CCNA_02885 in Caulobacter crescentus NA1000
Annotation: isochorismatase family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RUTB_CAUVN: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB) from Caulobacter vibrioides (strain NA1000 / CB15N)
KEGG orthology group: K09020, putative isochorismatase family protein RutB [EC: 3.-.-.-] (inferred from 100% identity to ccs:CCNA_02885)MetaCyc: 74% identical to ureidoacrylate amidohydrolase (Escherichia coli K-12 substr. MG1655)
RXN-12896 [EC: 3.5.1.110]; 3.5.1.110 [EC: 3.5.1.110]
Predicted SEED Role
"Predicted amidohydrolase RutB in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization
MetaCyc Pathways
- uracil degradation III (5/5 steps found)
- L-citrulline degradation (3/3 steps found)
- urea degradation I (3/3 steps found)
- L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
- cyanate degradation (2/3 steps found)
- cyanuric acid degradation II (3/5 steps found)
- superpathway of allantoin degradation in yeast (3/6 steps found)
- cyanuric acid degradation I (2/5 steps found)
- superpathway of atrazine degradation (3/8 steps found)
- allantoin degradation IV (anaerobic) (3/9 steps found)
KEGG Metabolic Maps
- Drug metabolism - other enzymes
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
- Puromycin biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 3.-.-.-
Use Curated BLAST to search for 3.-.-.- or 3.5.1.110
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B8H1Q1 at UniProt or InterPro
Protein Sequence (238 amino acids)
>CCNA_02885 isochorismatase family protein (Caulobacter crescentus NA1000) MSSPITPLSPGCVMLPARPEPLPVDPKTTAVIVIDMQNAYASPGGYLDLAGFDISGAAKV THEIKGVLEVARSAGMTVIYFQNGWDDGYVEAGGPGSPNWWKSNALKTMRARPELQGKLL ARGQWDYELVDDLTPQPGDIRLHKTRYSGFFNSQLDSVLRARGIRHLVFTGIATNVCVES TLRDGFMLEYFGTVLEDATHQAGPDFVQKAALFNIETFFGWVSTTADFKGTFGQLAPG