Protein Info for CCNA_02850 in Caulobacter crescentus NA1000

Annotation: cytochrome c-type biogenesis protein ccmI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 92 to 113 (22 residues), see Phobius details TIGR03142: cytochrome c-type biogenesis protein CcmI" amino acids 3 to 113 (111 residues), 80.3 bits, see alignment E=7e-27 PF14559: TPR_19" amino acids 141 to 195 (55 residues), 30.5 bits, see alignment 7.5e-11

Best Hits

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 100% identity to ccr:CC_2762)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmH" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBP2 at UniProt or InterPro

Protein Sequence (370 amino acids)

>CCNA_02850 cytochrome c-type biogenesis protein ccmI (Caulobacter crescentus NA1000)
MIAFWIAAAGLSVVTAGLVLRGAAQARAVDDAETRLEPHRRRLAEVERLALDGLLAEDEL
KAARAESGRGLLAAADQAESWSRDGAGPRKAAVAAVGLTCASAVGLYLVLGYPGLPDQPF
AKRVAAWRAADPATLEPAKIAAVLEGVAAERPNDPEPLVFMAKARAAAGDMAGAEQALRK
AVRIAPKRADIWSLLGETFVIQAEGQVGPDAKLAFGQALKVDAADVRARYYLGRARIAEG
EVAAGLSDWRGLLASLAPNAPGRESLAAEIAEVEASGKLPGPQPAAESANPEVQGMIAGM
VDGLAQRLKQSPDDPDGWVRLVRAYAVLGETAKRDAALATASALFKDQPKVMSALRQAAD
TPAQAKTTNP