Protein Info for CCNA_02840 in Caulobacter crescentus NA1000

Annotation: MecR1 antirepressor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details PF05569: Peptidase_M56" amino acids 8 to 78 (71 residues), 51.1 bits, see alignment E=5.8e-18 amino acids 78 to 233 (156 residues), 168.4 bits, see alignment E=1.1e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2754)

Predicted SEED Role

"Regulatory sensor-transducer, BlaR1/MecR1 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CD85 at UniProt or InterPro

Protein Sequence (295 amino acids)

>CCNA_02840 MecR1 antirepressor protein (Caulobacter crescentus NA1000)
MIELFALALIRAQIAAAAAVLLVLILRPSARRLFGPRRAYGLWLIVPAAAAAAFFPSLAD
TMNIGAPTRPLGAWAPKLVVLWLAGCAIATAVLVLRERLFRRRVDQGRAGPAVMGALWPR
IVLPADFTQRFDARERDLIVLHERTHIQRGDPIANLFIAGAGVLCWCNPMIALAQHFIRI
DQELACDATVVALRSDIRTDYARALMKAQMSGSVSPLACGWATHPLILRVSLLSRREPSL
HRDIAGFLTMTFLAIMAMVGVWSVAPRGPDYRDLRPGLAPQMDPFTGAITWVQGE