Protein Info for CCNA_02757 in Caulobacter crescentus NA1000

Annotation: sugar fermentation stimulation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR00230: sugar fermentation stimulation protein" amino acids 5 to 220 (216 residues), 208.6 bits, see alignment E=4.3e-66 PF17746: SfsA_N" amino acids 13 to 79 (67 residues), 69.7 bits, see alignment E=1.9e-23 PF03749: SfsA" amino acids 83 to 220 (138 residues), 154.4 bits, see alignment E=1.6e-49

Best Hits

Swiss-Prot: 100% identical to SFSA_CAUVC: Sugar fermentation stimulation protein homolog (sfsA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K06206, sugar fermentation stimulation protein A (inferred from 100% identity to ccr:CC_2675)

Predicted SEED Role

"Sugar/maltose fermentation stimulation protein homolog" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H0Z4 at UniProt or InterPro

Protein Sequence (239 amino acids)

>CCNA_02757 sugar fermentation stimulation protein A (Caulobacter crescentus NA1000)
MLLPQPLIHGRLVSRYKRFFADLVLDDGQEITAHCPNPGAMLGVKDAGQGAWVSWSDDPK
RKLAYTLQMVEQGNALVGINTLLPNKLVAEALAADALPELSGYATIKPEVKYAEASRVDF
LLTHPDRPPCWLEVKNCHFSRTPGLAEFPDCKAQRSTRHLEDLSAQVREGHRAVVLFVVQ
REDCETFSACAELDPAFAAGLEAAAKAGVEVLVYACEMGTQAVRIARRILWSHAHLTAI