Protein Info for CCNA_02742 in Caulobacter crescentus NA1000

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 48 to 70 (23 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 277 (260 residues), 37.2 bits, see alignment E=8.8e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02742)

Predicted SEED Role

"FIG00481931: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CD00 at UniProt or InterPro

Protein Sequence (423 amino acids)

>CCNA_02742 hypothetical protein (Caulobacter crescentus NA1000)
MTASRFRPWLLLAAFSLLLFLITASTYGSLGVVLPAMIGELNWSFEKAFLGFSVLGVFTG
ASSWLPAILIRRIGVRGTLLVGAAVLAGGFVGLANAESLVSYYVGAAACGVGFQMAALIP
GTHVLSSLFRERALPFGLYFTFGSLGGAAGPWMVLTLMDASGGDWRAFWIVQAVLAAAVG
GLCALMVGGSQWLAAAAREVDVEVEQAARQAPANARVYRTAHEWTVRQALRTPQFYILVA
AYFSHLLAGVTVASVSVSHLTEIGVAAGVAAVAAGALAAKMLSLEALMQTLARLAGGALG
DRVDPRWLLVFAQAMLVIGLLALAKAATPALMLVYAIGTGVGFGLTVLAVTVLLLNYYGR
QSNLELFSLTCLVGAVSAAGPFIAGAMRDRLGSFAPTFELFAAVTAVVFVAVLAMRPPRT
PIA