Protein Info for CCNA_02737 in Caulobacter crescentus NA1000

Annotation: queuosine biosynthesis protein QueF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR03139: 7-cyano-7-deazaguanine reductase" amino acids 20 to 129 (110 residues), 142.3 bits, see alignment E=2.9e-46 PF14489: QueF" amino acids 55 to 131 (77 residues), 106.9 bits, see alignment E=2.6e-35

Best Hits

Swiss-Prot: 100% identical to QUEF_CAUVN: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K09457, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 100% identity to ccs:CCNA_02737)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H0X4 at UniProt or InterPro

Protein Sequence (151 amino acids)

>CCNA_02737 queuosine biosynthesis protein QueF (Caulobacter crescentus NA1000)
MTDLNVTQLGRVVDAPESPEAAVLERVPNPQSDVLYLARFVAPEFTSLCPVTGQPDFAHL
VIDYAPGDWLIESKSLKLYLTSFRNHGSFHEDCTVKVARKIVEIAQPRWLRIGGYWYPRG
GIPIDVFWQTGPAPEGLWVPDQGVAPYRGRG