Protein Info for CCNA_02734 in Caulobacter crescentus NA1000

Annotation: serine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to CYSE_ECOL6: Serine acetyltransferase (cysE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00640, serine O-acetyltransferase [EC: 2.3.1.30] (inferred from 100% identity to ccs:CCNA_02734)

MetaCyc: 54% identical to serine acetyltransferase (Escherichia coli K-12 substr. MG1655)
Serine O-acetyltransferase. [EC: 2.3.1.30]

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
L-cysteine biosynthesis I (2/2 steps found)
seleno-amino acid biosynthesis (plants) (3/5 steps found)
L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (2/4 steps found)
N-3-oxalyl-L-2,3-diaminopropanoate biosynthesis (1/4 steps found)
L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
D-cycloserine biosynthesis (1/6 steps found)
superpathway of seleno-compound metabolism (8/19 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBB9 at UniProt or InterPro

Protein Sequence (290 amino acids)

>CCNA_02734 serine acetyltransferase (Caulobacter crescentus NA1000)
MLASRLGREIPMPKHLEVVTSDTETPVWVALRNQAEHAAKAEPALASLLNAVILSHDNLA
DALTFQLARKLGDQEMRAMTAREFAADAFEDDLSIVEAAEADLKAVFERDPACKGYVQPF
LFFKGFLALQTHRVSHWLWNQGRETLAFYLQSRSSEVFQVDINPAAKIGKGVFIDHGTGI
VIGETAVVGDDVSMLHGVTLGGTGAERGDRHPKIGKGVLLGAGAKVLGNITVGDYAKVAS
GSVVLRPVPAHCTAAGVPARLVNCPTCEEPAKTMDHTLAEAVYSTSSYEI