Protein Info for CCNA_02712 in Caulobacter crescentus NA1000

Annotation: holdfast attachment protein hfaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03783: CsgG" amino acids 68 to 273 (206 residues), 52.4 bits, see alignment E=2.2e-18

Best Hits

Swiss-Prot: 100% identical to HFAB_CAUVC: Putative transcription activator protein HfaB (hfaB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K13586, holdfast attachment protein HfaB (inferred from 100% identity to ccr:CC_2629)

Predicted SEED Role

"Curli production assembly/transport component CsgG" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9T7 at UniProt or InterPro

Protein Sequence (337 amino acids)

>CCNA_02712 holdfast attachment protein hfaB (Caulobacter crescentus NA1000)
MMVKRTGAVLALLATAALSACGSTPVASTAGNYAKPIGTAPVTANPTDYSSALVCLNQYA
RTNRIVAPRIAIGRIADYTGKEESDGSGRKVTQGASLMAVSAFAKAGMPLVERFDTSVSE
FELKYANNKLISDRPNPAPDAPADFRKILAGQVPGSDFYVIGGITELNYNIRSAGIDAYA
GDKDTDGLKGNFRRRVFIMNIALDLRLVNTRTLEVVDVISYQKQVVGREVSAGVFDFLNG
NLFDISAGRGALEPMQLAVRALIERATVEMAANLYGMPGPESCLRFDPFGDATVGQTGAF
TPAYNNLGTNNAQTRDDPSRWNARRDPDIRDAKRGRY