Protein Info for CCNA_02710 in Caulobacter crescentus NA1000

Annotation: rhomboid family protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 56 to 82 (27 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details PF01694: Rhomboid" amino acids 52 to 202 (151 residues), 93 bits, see alignment E=9.6e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2627)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBB7 at UniProt or InterPro

Protein Sequence (218 amino acids)

>CCNA_02710 rhomboid family protease (Caulobacter crescentus NA1000)
MDQPQRPEPILNAPWPALLVAAAVIIPHLLLQGASQEVIYSLALVPREFWEGRWTGAVTM
LFVHGGWIHAIMNAAFGLAFGAPVSRVLGLNVRGGGIFCLFYLVCGVIAGVGFAAIHPEG
MSPVVGASGAIAGLMGAAARTMDSAPGQLGPMFGPRVISLGLGWLVVNLVLAVTGSLLTM
GAGGVAWEAHLIGFAVGVLLIGPFARWAGPSAQIADPH