Protein Info for CCNA_02699 in Caulobacter crescentus NA1000

Annotation: guanine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02967: guanine deaminase
  • amino acids 24 to 422 (399 residues), 599 bits, E=2.2e-184
• PF01979: Amidohydro_1
  • amino acids 64 to 422 (359 residues), 213.9 bits, E=3.9e-67
• PF07969: Amidohydro_3
  • amino acids 254 to 385 (132 residues), 52.9 bits, E=4.6e-18

Best Hits

Swiss-Prot: 56% identical to GUAD_ECOLI: Guanine deaminase (guaD) from Escherichia coli (strain K12)

KEGG orthology group: K01487, guanine deaminase [EC: 3.5.4.3] (inferred from 100% identity to ccs:CCNA_02699)

MetaCyc: 56% identical to guanine deaminase (Escherichia coli K-12 substr. MG1655)
Guanine deaminase. [EC: 3.5.4.3]

Predicted SEED Role

"Guanine deaminase (EC 3.5.4.3)" in subsystem Purine Utilization or Purine conversions (EC 3.5.4.3)

MetaCyc Pathways

• purine nucleotides degradation I (plants) (10/12 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• superpathway of purines degradation in plants (12/18 steps found)
• purine nucleobases degradation II (anaerobic) (14/24 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.3

Sequence Analysis Tools

See A0A0H3CCV3 at UniProt or InterPro

Protein Sequence (428 amino acids)

>CCNA_02699 guanine deaminase (Caulobacter crescentus NA1000)
MQAFRASILHLLDDPAKAAEGAVAFHEDGLLLVEDGRVIGCGAYAELAPWLGGAELEDLT
GHLITPGFVDTHIHFPQVDVIAAHGKQLLDWLEQHTFPAEAAFADPKHAADTAAFFLDEL
LRNGTTTALVFGSVHKVSVDALFAEAYARDMRLIAGKSLMDRNAPDGLTDTVESSREDMQ
ALIADWHGKGRLGYAVTPRFAISCSDAQLAMAGEILAEHPDVWMQTHLSENLHEIKETAR
LFPKAKDYLDVYDRFGLLRQRSVFAHCVHLKGDAFRRLAAKGGAVAFCPTSNLFLGSGLF
PLEEACSHGVKVGIGTDVGAGTTFSILHTLGEAYKVGQLRGDALDPFQALYLATLGGARA
LDLDDKIGNLAPGKEADFLVLDLAATPLIARRLAGGKSLADKLFALTVLGDDRVVARTYL
AGVERWRR