Protein Info for CCNA_02641 in Caulobacter crescentus NA1000

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 25 to 76 (52 residues), 27 bits, 7.3e-10
• TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  • amino acids 30 to 452 (423 residues), 318.7 bits, E=3.1e-99
• PF08245: Mur_ligase_M
  • amino acids 104 to 293 (190 residues), 142.5 bits, E=2.6e-45
• PF02875: Mur_ligase_C
  • amino acids 328 to 395 (68 residues), 28.2 bits, E=2.9e-10

Best Hits

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 100% identity to ccs:CCNA_02641)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

See A0A0H3C9K8 at UniProt or InterPro

Protein Sequence (462 amino acids)

>CCNA_02641 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Caulobacter crescentus NA1000)
MPDALWTADEIAEAVGGQVAGDFAVSGVSIDTRTVEPGDLFVPLVGVRDGHDFVPQAVAN
GAAGVLAARAVDAPAVMVADTFKALEALGVAARERAPQCKRGAVTGSVGKTSVTRAIEAG
LRLAGKAHASVKSYNNHIGVPLTLARMPRDTERAVFEVGMNHAGEIVPLSGFVRPHAVAI
TTVGPVHIENFSDGEAGVARAKAEILAGLQPGGIAVLNADNHWFDFLKGEAEKVGATVWS
FGEAAGATARLTGFQVEGAGATVSVDLRGEALTFPIHQTGVHWGPNSLCVLLMLEALDVP
RETALAALAAFAPIEGRGAEKTIRIPGGAFTLVDESYNANPVSMQAALKTLGARKVAGRR
VVALTDMLELGEGSAQFHAELAEPIAAANVDAVFLAGVHMKSLWEALPPTRRGGYAEVAE
KLTSVLAGAVQPGDVVMVKGSNGSKAGVLAAALAALDLGEQG