Protein Info for CCNA_02639 in Caulobacter crescentus NA1000

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF21799: MurD-like_N" amino acids 10 to 98 (89 residues), 33.1 bits, see alignment E=8.7e-12 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 11 to 459 (449 residues), 376.1 bits, see alignment E=1.4e-116 PF08245: Mur_ligase_M" amino acids 121 to 303 (183 residues), 104.6 bits, see alignment E=1e-33 PF02875: Mur_ligase_C" amino acids 324 to 386 (63 residues), 24.9 bits, see alignment E=3.1e-09

Best Hits

Swiss-Prot: 100% identical to MURD_CAUVC: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to ccr:CC_2556)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H096 at UniProt or InterPro

Protein Sequence (471 amino acids)

>CCNA_02639 UDP-N-acetylmuramoylalanine--D-glutamate ligase (Caulobacter crescentus NA1000)
MIPVRGFEDKTVAVFGLGRTGLTAARALIAGGAKVALWDEKPASREAAAAEGFAVVDLQA
ADWSQFAALMLSPGVPLSHPKPHWTVEKARAAGVEVLGDVELFARTVNAAPAHKRPKIIA
ITGTNGKSTTTALIGHLCASAGRDTRVGGNIGLGVLGLEDMHGGAVYVLELSSYQLDLTS
SLKPDAVVLLNISPDHLDRHGGMDGYIAAKRRIFLNQGKGDTAIIGVDDAWCQQICTEIT
AANRRTIWPISAGKAMGRGVYALQGVLYDATGERVVEVADILRARSLPGRHNWQNAAAAY
AAARAIGISMQDAVDGLMTFPGLAHRMETVGKIGKVRFVNDSKATNADAARQAMSSYPKF
YWIAGGVAKAGGIDDLKDLFPRIAKAYLIGEAAEPFSWTLAGKAECVLSGTLEKAVQQAY
ADAAASGEEAIVLLSPACASFDQFSDFEARGEAFRAAVNGLTAGGGKAAVA