Protein Info for CCNA_02629 in Caulobacter crescentus NA1000

Annotation: UDP-N-acetylmuramate--alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01082: UDP-N-acetylmuramate--L-alanine ligase
  • amino acids 15 to 461 (447 residues), 523.2 bits, E=3.4e-161
• PF01225: Mur_ligase
  • amino acids 15 to 111 (97 residues), 107.2 bits, E=6.7e-35
• PF08245: Mur_ligase_M
  • amino acids 117 to 302 (186 residues), 93.2 bits, E=3.3e-30
• PF02875: Mur_ligase_C
  • amino acids 322 to 407 (86 residues), 58.8 bits, E=8.1e-20

Best Hits

Swiss-Prot: 100% identical to MURC_CAUVN: UDP-N-acetylmuramate--L-alanine ligase (murC) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to ccr:CC_2546)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

See B8H086 at UniProt or InterPro

Protein Sequence (473 amino acids)

>CCNA_02629 UDP-N-acetylmuramate--alanine ligase (Caulobacter crescentus NA1000)
MIQRRRPVPFELGPVHFIGIGGIGMSGIAEIMIRIGYTVQGSDAKASANTERLEKLGARI
FIGHDAAHVEGASAIVYSTAVKADNPEMVAGRDKRLPLVRRAEMLAELMRLQFSVAVGGT
HGKTTTTSMVAALLDAGGLDPTVVNGGIINAYGTNAKVGEGDWIVVEADESDGSFLKLKS
TVAIVTNIDAEHLDHWGDFDAVKKGFQDFIQNIPFYGFAAVCTDHPEVQALTSRIENRRL
VTYGTNPQAEVRVSNIEMGPEGATFDIIVSPRAGEAVRYDGLKMPMAGHHNVLNATAAVA
VARELGVDAEAIAKGLAGFGGVKRRFTTTGVANGIRVVDDYGHHPVEIAAVLKAARAVTP
NGKVIAVVQPHRFTRLRDLMTEFSSCFNDADTVIVADVYTAGEQPIPGVDRDALVAGLKK
FGHRRALPLENPTALPRLIAAEATSGDLVVLLGAGDITTWSYALPGQLEALTK