Protein Info for CCNA_02626 in Caulobacter crescentus NA1000

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 15 to 314 (300 residues), 258.4 bits, E=4e-81
• PF01820: Dala_Dala_lig_N
  • amino acids 63 to 95 (33 residues), 38.9 bits, 1.8e-13
• PF02655: ATP-grasp_3
  • amino acids 106 to 283 (178 residues), 28.6 bits, E=2.1e-10
• PF07478: Dala_Dala_lig_C
  • amino acids 138 to 311 (174 residues), 133.6 bits, E=1e-42

Best Hits

Swiss-Prot: 100% identical to DDL_CAUVC: D-alanine--D-alanine ligase (ddl) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 100% identity to ccs:CCNA_02626)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

See A0A0H3CA93 at UniProt or InterPro

Protein Sequence (324 amino acids)

>CCNA_02626 D-alanine--D-alanine ligase (Caulobacter crescentus NA1000)
MTQQPQADAPLAGRHIAVLLGGPSSERKVSLVSGAACAEALERLGAKVSRIDPGPDVAQV
LAATKPDMVFNALHGEWGEDGCVQGVLETLKLPYTHSGVLASALAMDKAKAKAVLAAAGV
TVPGGGLFNRHDVARDHVLQPPYVVKPNAEGSSVGVFIIKEGANRPPEEVGAPSWTFGEE
VMVEPYIQGMELAVAVLGESNGPRALAVTDIRASTGFYDYEAKYSEGGSIHVLPAPIPNA
VRDRAMRMAELAHTALGCRGVTRSDFRYDDINDLLVLLEVNTQPGMTPTSLAPEQADHVG
IPFDQLVLWIVEDAYARCSAGGTA