Protein Info for CCNA_02625 in Caulobacter crescentus NA1000

Annotation: cell division protein FtsQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 50 to 70 (21 residues), see Phobius details PF08478: POTRA_1" amino acids 94 to 162 (69 residues), 64.6 bits, see alignment E=8.6e-22 PF03799: FtsQ_DivIB_C" amino acids 166 to 279 (114 residues), 65.6 bits, see alignment E=7.4e-22

Best Hits

Swiss-Prot: 100% identical to FTSQ_CAUVC: Cell division protein FtsQ (ftsQ) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 100% identity to ccs:CCNA_02625)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H082 at UniProt or InterPro

Protein Sequence (302 amino acids)

>CCNA_02625 cell division protein FtsQ (Caulobacter crescentus NA1000)
MPAVVRGGPPKPRRPRAEAPASPSKGKPAPRKAQPAAKLHAARGVGLSPTVALSVAGAAL
GLGLVVMLATGHRAERLGASMVRGVDNTFASAGFRLKTVHIRGASATAQADILKASGLYL
DQPTLGMDLADVRDRVQGVGWVKDAKVVRMLPDTVLIAVEERPALAVWQNHGRMKVIDSE
GQVITEADPARFPQLPLVVGQGADQAAGLILPAVASRPRLRDRLEAMVRVDERRWDLRLK
DGSLIQLPAIDEESALIQLDQLDQRQRILDMGFARIDLRDPEMVAVRPRDAVLPGQPAAD
GA