Protein Info for CCNA_02624 in Caulobacter crescentus NA1000

Annotation: cell division protein FtsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 TIGR01174: cell division protein FtsA" amino acids 24 to 398 (375 residues), 301.8 bits, see alignment E=3.8e-94 PF02491: SHS2_FTSA" amino acids 103 to 179 (77 residues), 61.8 bits, see alignment E=1e-20 PF06723: MreB_Mbl" amino acids 203 to 372 (170 residues), 33.1 bits, see alignment E=4.4e-12 PF14450: FtsA" amino acids 225 to 395 (171 residues), 107.4 bits, see alignment E=1e-34

Best Hits

KEGG orthology group: K03590, cell division protein FtsA (inferred from 100% identity to ccs:CCNA_02624)

Predicted SEED Role

"Cell division protein FtsA" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9K0 at UniProt or InterPro

Protein Sequence (441 amino acids)

>CCNA_02624 cell division protein FtsA (Caulobacter crescentus NA1000)
MSRMEDRKQAREGLKATLVRQPAIAAVDLGASKVTCFIMKADGVHRDNRTLTTAGVGYVQ
SRGVRGGAIVNLDEAAQAIAQAVERAETVAGVSVQGVSVCTAGGQLASHRVHTQVSLGAR
PIGDGDLSRAIASALAQVRIPGRKPIHLLPIAWSVDGQRGIRDPRAMFGRALGLELLVVS
VNENIFHTLAHCVERAHLSFEGIVAAPFASALAALEEDEMDLGAVCIDMGGGSTSVAVFN
NGALCHVDSLAVGGGHVTQDIARGLQTSVVGAERIKTLHGSAIASANEDREMIEAPPRGD
DPGAGPVIAPRSLLKGIIQPRVEETLELLRERLKASGAPVEPGAGIVLTGGASQLAGVRE
VAVRVFDRPVRLGRPRRVPHLADAASGPAFCAAAGVLHRTAFGPREAVSSKALAGGVARK
RPIDPNASPMAKAAAWLRDNL