Protein Info for CCNA_02621 in Caulobacter crescentus NA1000

Annotation: CAAX amino terminal protease family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details PF02517: Rce1-like" amino acids 140 to 235 (96 residues), 59.8 bits, see alignment E=1.3e-20

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 100% identity to ccs:CCNA_02621)

Predicted SEED Role

"CAAX amino terminal protease family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CB38 at UniProt or InterPro

Protein Sequence (309 amino acids)

>CCNA_02621 CAAX amino terminal protease family (Caulobacter crescentus NA1000)
MKNVELYGPRAPKHRRTWTAAAIPLIIVFFIVGQLATIFGVLKPMGFHQADLESQWSPLA
IQLAGFGFSALLLLAWVWLFERRSPLVLGLNGEFVRRYTWGLLVGCGFLLSVIGLIWATG
GYRIEGFGVWTAPSPMLFLPILALFAGFVIQGGTEELLMRGWLMQLVASRHGLVIAIVIN
SVLFAILHGGNIAPSKELALALANLILFGVMISLYAIKEGSLWGVCAWHTAWNWLLGVGF
GLEVSGGRMAVQSLVIDLAPKDGAPWWLTGGAFGPEASVVTTIVLLAGCAYFGATGALGA
ARARSAALG