Protein Info for CCNA_02616 in Caulobacter crescentus NA1000

Annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14696: Glyoxalase_5
  • amino acids 7 to 141 (135 residues), 151.3 bits, E=3.9e-48
• TIGR01263: 4-hydroxyphenylpyruvate dioxygenase
  • amino acids 14 to 352 (339 residues), 426.2 bits, E=6.8e-132
• PF00903: Glyoxalase
  • amino acids 162 to 272 (111 residues), 48.2 bits, E=2.8e-16
• PF13669: Glyoxalase_4
  • amino acids 180 to 265 (86 residues), 27.6 bits, E=6.4e-10

Best Hits

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 100% identity to ccs:CCNA_02616)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)
• plastoquinol-9 biosynthesis I (1/3 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• vitamin E biosynthesis (tocopherols) (1/7 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

See A0A0H3CB33 at UniProt or InterPro

Protein Sequence (357 amino acids)

>CCNA_02616 4-hydroxyphenylpyruvate dioxygenase (Caulobacter crescentus NA1000)
MTLVTDQNPLGLDGFEFVEFTSPDPAAMKALIEQLGFVAASKHPTKAATRYKQGRVNLIV
NEETTGQVADFRADHGPSANGMAFRVENAEQAYADAVKRGAKPADASRSLLGADAKVLEG
IGGSLLYLVDRYGDAGTIYDAWEQVPGAALAEAKNNVGLDLLDHLTHNVKRGQMRTWSTF
YNQIFGFEEQKYFDIKGQATGLFSQAMIAPDKAIRIPLNESQDDKSQIEEFIRQYNGEGI
QHLAMTTDNIYDTVEKLRARGVKLQDTIETYYELVDKRVPGHGEDLERLRKNRILIDGAV
GEEGLLLQIFTENLFGPIFFEIIQRKGNEGFGNGNFQALFESIELDQIRRGVITVDA