Protein Info for CCNA_02614 in Caulobacter crescentus NA1000

Annotation: fumarylacetoacetase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF18288: FAA_hydro_N_2
  • amino acids 1 to 76 (76 residues), 77.8 bits, E=6.7e-26
• PF01557: FAA_hydrolase
  • amino acids 80 to 332 (253 residues), 107.4 bits, E=8.8e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2531)

Predicted SEED Role

"Fumarylacetoacetase (EC 3.7.1.2)" in subsystem Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 3.7.1.2)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)

KEGG Metabolic Maps

• Styrene degradation
• Tyrosine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.2

Sequence Analysis Tools

See A0A0H3CB03 at UniProt or InterPro

Protein Sequence (335 amino acids)

>CCNA_02614 fumarylacetoacetase superfamily protein (Caulobacter crescentus NA1000)
MKLASLKGGRDGRLVVVSNDLAWFTDAGTIAPTLQAALDNWERCGPMLAGLAESLEHGAV
PKERFHEHEALSPLPRAYQWVDGSAYVNHVQLVRKARGAEMPESFWTDPLMYQGASDGFL
APRDPIPLADASWGCDLEGEVAVIVDDVPLGATREEALAAIRLVMLCNDVSLRNLIPGEL
AKGFGFLQSKPASAFSPVAVSPDALGEAWKGGKLHGALLVELDGKDFGRADAGVDMTFDF
GTLVAHAAKTRSLCAGTIVGSGTVSNRDADGGPGKPISEGGLGYSCLAEVRTVETLLHGA
PKTPFLLGGDTIRIEMKDAKGHSIFGAIEQTVERI