Protein Info for CCNA_02592 in Caulobacter crescentus NA1000

Annotation: thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01643: Acyl-ACP_TE
  • amino acids 12 to 132 (121 residues), 29.6 bits, E=7.6e-11
• PF20791: Acyl-ACP_TE_C
  • amino acids 13 to 114 (102 residues), 40.7 bits, E=3.5e-14
• PF13279: 4HBT_2
  • amino acids 20 to 135 (116 residues), 64.2 bits, E=2.4e-21

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 100% identity to ccs:CCNA_02592)

Predicted SEED Role

"FIG00481523: hypothetical protein"

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

See A0A0H3CAX7 at UniProt or InterPro

Protein Sequence (139 amino acids)

>CCNA_02592 thioesterase (Caulobacter crescentus NA1000)
MSRLFVPPSDAYTLTFTPKASDIDANGHVNNVVYLGWAQDLAITHWDAWTTPEERAPWSW
VARRHEVDYRRELLPGEVATGYTWVGELKGPRFERYIRIDGPDGEMCAQVRTDWVLIDIA
AKRPARVLPWMIERFTPKG