Protein Info for CCNA_02587 in Caulobacter crescentus NA1000

Annotation: PAS-family sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 99 to 217 (119 residues), 50.9 bits, see alignment E=8.3e-18 PF00989: PAS" amino acids 104 to 210 (107 residues), 35.6 bits, see alignment E=2.9e-12 PF08448: PAS_4" amino acids 109 to 215 (107 residues), 31.9 bits, see alignment E=4.9e-11 PF13426: PAS_9" amino acids 122 to 212 (91 residues), 28.5 bits, see alignment E=5.4e-10 PF08447: PAS_3" amino acids 125 to 200 (76 residues), 35.5 bits, see alignment E=3.4e-12 PF00512: HisKA" amino acids 233 to 299 (67 residues), 73.2 bits, see alignment E=5.1e-24 PF02518: HATPase_c" amino acids 346 to 457 (112 residues), 99.5 bits, see alignment E=5.5e-32 PF00072: Response_reg" amino acids 483 to 595 (113 residues), 91.2 bits, see alignment E=1.7e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2501)

Predicted SEED Role

"FIG00482821: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAX2 at UniProt or InterPro

Protein Sequence (605 amino acids)

>CCNA_02587 PAS-family sensor histidine kinase (Caulobacter crescentus NA1000)
MNPAAIRVRILRAVPAVCLIVGVAMAMDYIVTILLLNEPAAYVPIATLVISTIIAVPLAY
WLAGQRLRLETMHAELKASLDAKQDAIEDAEVALAKYREVDRLYRLLGDNLTDHVALWSP
LGERLYSSPSIERITGYTLEEFMALPPAALVGEADFRRVQGIIRSLEPGGEPVSADYESL
CKDGSRIWVESTYSLLGDGSGILLVTSRDITERKRLELDIAKALQMAEAASAAKSDFLAN
MTHELRTPLTAIIGFAEVLRRSRNLNKTAARQVGHILDASNTLLSVVNDVLDFSRLEAGG
LELDPAPFDPAAMASSCAGLVAERAEAKGLAVEVRAPRGLKPMNLDGPRLSQVLLNFLSN
AVKFTSHGAITVALRQTIDGDQAVLRGEVTDTGIGIAPEHRENIFDRFSQADAAVSRRFG
GTGLGLAISRRIIERMDGRIGVDSVEGQGSTFWFEVRGPLADLPTQEAVETSPLDADAGV
RLLLVEDNAVNRELICAILEPFGVAIETANDGVAGVEAMRQGHYDLVLMDVQMPMMDGLT
ATREIRAMEGARGASTPIIAMTANVLPEQVANCMAAGMDDHLGKPISPAKLLEAVARWSG
RSHAA