Protein Info for CCNA_02572 in Caulobacter crescentus NA1000

Annotation: adenylosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00928: adenylosuccinate lyase
  • amino acids 1 to 432 (432 residues), 490.7 bits, E=1.9e-151
• PF00206: Lyase_1
  • amino acids 7 to 287 (281 residues), 176 bits, E=1.3e-55
• PF10397: ADSL_C
  • amino acids 353 to 431 (79 residues), 89.1 bits, E=1.9e-29

Best Hits

Swiss-Prot: 50% identical to PUR8_BACSU: Adenylosuccinate lyase (purB) from Bacillus subtilis (strain 168)

KEGG orthology group: K01756, adenylosuccinate lyase [EC: 4.3.2.2] (inferred from 100% identity to ccs:CCNA_02572)

Predicted SEED Role

"Adenylosuccinate lyase (EC 4.3.2.2)" in subsystem De Novo Purine Biosynthesis or Purine conversions (EC 4.3.2.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)
• dZTP biosynthesis (4/5 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.2

Sequence Analysis Tools

See A0A0H3CCG5 at UniProt or InterPro

Protein Sequence (436 amino acids)

>CCNA_02572 adenylosuccinate lyase (Caulobacter crescentus NA1000)
MISRYARPEAAAIWSSQTKYKIWFEIEAHAADAMAELGVIPKLAAETIWEKGRDAVWDSD
RIDEIERVTKHDVIAFLTHVSEIVGPEARFLHQGMTSSDVLDTCFAVQLSRATDLLLEDV
DLVLAALKRRALEHKMTVCVGRSHGIHAEPITFGLKLAGYYAEFQRAKERLAMAKFEIAT
CAISGAVGTFANVDPRVEQHVADKMGLAVEPVSTQVIPRDRHAAYFAALGVVASSVERLA
TEIRHLQRTEVLEAEEPFDPGQKGSSAMPHKRNPILTENLTGLARLVRSAVVPAMENVAL
WHERDISHSSVERGIGPDATIHLDFALRRLAGVIERFNIYPDNMAKNLDKLGGLVFSQRV
MLALTHKDVSREDAYAAVQGNAMKVWRGEGRFLDFLKADPVVSKALTETELEELFDLGYH
TKNVDVIFQRVFGEQG