Protein Info for CCNA_02570 in Caulobacter crescentus NA1000

Annotation: major facilitator superfamily transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 209 to 225 (17 residues), see Phobius details amino acids 231 to 257 (27 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 413 to 434 (22 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 391 (366 residues), 147.5 bits, see alignment E=5e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02570)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAV4 at UniProt or InterPro

Protein Sequence (444 amino acids)

>CCNA_02570 major facilitator superfamily transporter (Caulobacter crescentus NA1000)
MAQPATPSPVIAPVSTAYRRYALWVLLIIYTLNFLDRQVVNILAEPIKRDLGLADWQLGM
MTGLAFAIFYTVLGIPIARMAETKNRPYIIGISVAVWSAFTVVCGFAQNFWQLILARIGV
GVGEAGCTPPAHSLISDYVPKEKRASAIAFYSIGTPLGTLAGMAMGGLVADAYGWRVAFM
VAGAPGLLFALIAAFTLVEPRKKLAAEMAARASTQISFAAALAVLATKKTFWLVALAASI
KAFIGYGYAPFIASFFFRVHGPEIAQLAGTFGLKSAGFLGLALGLINGTAGVIGAWLGGV
LADRLGAKDLRAYVTVPAIASVVTIPIFVVAMSLDAPMAAIGLLSVNALLATLWYGPVYA
TAQSIVDPALRATASAVLLLIINLIGLGFGPLIVGLLSDILAGPVGLGEAQGVRWALIIS
ATLGLGAFALFWAARKTIRDEMVS