Protein Info for CCNA_02508 in Caulobacter crescentus NA1000

Annotation: oligosaccharide translocase/flippase hfsF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details PF13440: Polysacc_synt_3" amino acids 60 to 258 (199 residues), 46.9 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2426)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCA8 at UniProt or InterPro

Protein Sequence (420 amino acids)

>CCNA_02508 oligosaccharide translocase/flippase hfsF (Caulobacter crescentus NA1000)
MARFLATRSEDGRIADHFATLYRLWLGAALAVPVVGGAVLAFAPLNGPLRIALAAGFAAV
LVNSLVKLAQERRRAAGEVSGAAMLSMVQTAGGFALGLGFALAGLGGAAPLLGIGIVSLA
CVAVVLSRELKFMTGGRFDKALARTYFTYGAPVALSLILALVLASTDRLLLATFLDEATV
GVYHAGYSLGSRTLDVVFIWLGMAGGPALIQALERGGQPALEDAAREQAGVIVLLTLPAA
VGLALVARPLADLMVGEAMREQASHVTPWIAASGWLSGVTTYYLLQAFTLARRTSLLIVS
MSAPALANVALNLVLIPRLGLDGALIATTVSYGLGAVAAWALGRRACPLPIPWAVLAKAA
GASLAMAACVALLPAPGGLLELVLKASVGAAVYGALVLGLDVAGLRGKLSLILRRKAQAA