Protein Info for CCNA_02502 in Caulobacter crescentus NA1000

Annotation: type IV secretory pathway, VirB6 channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 181 to 205 (25 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 261 to 287 (27 residues), see Phobius details PF04610: TrbL" amino acids 51 to 274 (224 residues), 121.1 bits, see alignment E=3e-39

Best Hits

KEGG orthology group: K03201, type IV secretion system protein VirB6 (inferred from 100% identity to ccs:CCNA_02502)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAU1 at UniProt or InterPro

Protein Sequence (386 amino acids)

>CCNA_02502 type IV secretory pathway, VirB6 channel protein (Caulobacter crescentus NA1000)
MDVCPAPPPTAGVIRGVLSTIDCHTRVYAQSGYEALNGPQSIFPTALTLMLTLYIALLGY
RMLLGVSTTRLTDAPLIALKVGVVLSLALNWNTFQTLVFDVTMKAPLQLAQTIGAPAAAS
GAALVSDPLGGLQVTYDELARSASALGKLAGPNPEVLRGGEAAAAQALWQAQTALFMSTA
GVMAIAIIAVGVLSATGPVFIALVMFDATRGLFEGWLRALLAAAFIPMLCWSATTLLLVV
VDPLLVRLAQGRLAGAPDTQAAVMVSAIVFIFAAAQAALTVGAAVMAGGFRPGGADQRAG
PAPRSEGAAASPAPALSRPDRLAQSLQARSAPTSHTLAAISLAASASPLTAPPRATLASP
RAQAREEPHRRSAFMDHYRNLTGGSR