Protein Info for CCNA_02495 in Caulobacter crescentus NA1000

Annotation: 4-hydroxybenzoate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 53 to 71 (19 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 347 to 372 (26 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 363 (342 residues), 172.4 bits, see alignment E=2.7e-54 amino acids 251 to 401 (151 residues), 43 bits, see alignment E=5.7e-15 PF06609: TRI12" amino acids 25 to 191 (167 residues), 32.1 bits, see alignment E=9.2e-12 PF06779: MFS_4" amino acids 40 to 393 (354 residues), 28.6 bits, see alignment E=1.9e-10 PF00083: Sugar_tr" amino acids 52 to 196 (145 residues), 67.9 bits, see alignment E=1.7e-22

Best Hits

KEGG orthology group: K05819, MFS transporter, AAHS family, 3-hydroxyphenylpropionic acid transporter (inferred from 100% identity to ccr:CC_2412)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9X6 at UniProt or InterPro

Protein Sequence (405 amino acids)

>CCNA_02495 4-hydroxybenzoate transporter (Caulobacter crescentus NA1000)
MTTKGRSAAGTHGGLVAVAICCLLAVFEGFDLQAAGVAAPRLAPDLGLKPEDLGWFFSIS
TFGLMVGAALGGRLSDRFGRKVTLLVSVAAFGLLSIATGLAQDLNGLLVARFLTGVGLGG
ALPNLIAIVAESVSPKLRGRAVGFLYAGLPCGGALASLVSLAGADPSDWRIVFFVGGVGP
LLAMLLAMVLLPDTPMAQVGPVGDQKSGFVEALAGEGRGLTTLLLWIAFFLALLIMYLLL
SWLPSLMIGRGLSRSDAGLIQMAFNLAGAAGSVATGWLMDHRRWRTLTILGAFGASAAAM
ATAAAAPASLAVFLIVGAALGATVSGVQSVVYGLAPGFYPARLRGTGVGAAVVVGRLGSA
AGPLLAATLIGAGGSSNQVLLALMPVIALGGLVSLLLATRPHSGD