Protein Info for CCNA_02494 in Caulobacter crescentus NA1000

Annotation: 3-oxoadipate enol-lactonase/4-carboxymuconolactone decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR02427: 3-oxoadipate enol-lactonase" amino acids 10 to 257 (248 residues), 324.4 bits, see alignment E=2.3e-101 PF12697: Abhydrolase_6" amino acids 37 to 251 (215 residues), 64.8 bits, see alignment E=4.5e-21 PF00561: Abhydrolase_1" amino acids 39 to 246 (208 residues), 80.3 bits, see alignment E=4.7e-26 PF12146: Hydrolase_4" amino acids 42 to 228 (187 residues), 55.9 bits, see alignment E=1e-18 PF03096: Ndr" amino acids 43 to 256 (214 residues), 31.7 bits, see alignment E=1.7e-11 PF02627: CMD" amino acids 303 to 386 (84 residues), 64.2 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: K14727, 3-oxoadipate enol-lactonase / 4-carboxymuconolactone decarboxylase [EC: 3.1.1.24 4.1.1.44] (inferred from 100% identity to ccr:CC_2411)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24 or 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C984 at UniProt or InterPro

Protein Sequence (393 amino acids)

>CCNA_02494 3-oxoadipate enol-lactonase/4-carboxymuconolactone decarboxylase (Caulobacter crescentus NA1000)
MPFAVSQGARIYWRTDGAADKPLLVLLNSIGCDLSLHDPVTPLLTPDFRVLRIDTRGHGA
SDAPSGDYSLDLLADDVLAVMDAAGAAKATICGTSLGGMIAMALASRAPDRVEALVLACT
SPAMDSSSWEQRLAVIRAEGLSAIVEAVMSRFFSDDFRALHPEVVETVRAGMLAQNPDGY
CGCGAAIRDMALLDRLPKIAAPTLVLTGSKDVATPFEGHADRIVAAVPGARHAVIEAAHL
PSLEAPAAFAGAVRGFLAEVLHGAAVSDAKAVLFEAGLVTRRRVLGDAWVDKSLAKRTAF
TADYQAMITRYAWNEIWGRPGLDHRTRRLLVLAICASLARWEEFRLHVRAGLEQGGFTQD
ELKEVLMQIAIYAGVPAANTAFTEAADVMSELG