Protein Info for CCNA_02490 in Caulobacter crescentus NA1000

Annotation: 3-ketoacyl-CoA thiolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02430: 3-oxoadipyl-CoA thiolase
  • amino acids 3 to 399 (397 residues), 738.7 bits, E=1.6e-226
• PF00108: Thiolase_N
  • amino acids 5 to 267 (263 residues), 240.8 bits, E=2.5e-75
• TIGR01930: acetyl-CoA C-acyltransferase
  • amino acids 6 to 397 (392 residues), 448.6 bits, E=1.8e-138
• PF00109: ketoacyl-synt
  • amino acids 82 to 123 (42 residues), 28 bits, 2.5e-10
• PF02803: Thiolase_C
  • amino acids 275 to 398 (124 residues), 147.4 bits, E=2.3e-47

Best Hits

Swiss-Prot: 73% identical to PCAF_PSEKB: Beta-ketoadipyl-CoA thiolase (pcaF) from Pseudomonas knackmussii (strain DSM 6978 / LMG 23759 / B13)

KEGG orthology group: K07823, 3-oxoadipyl-CoA thiolase [EC: 2.3.1.174] (inferred from 100% identity to ccr:CC_2407)

MetaCyc: 72% identical to subunit of beta-ketoadipyl CoA thiolase (Pseudomonas putida)
3-oxoadipyl-CoA thiolase. [EC: 2.3.1.174]; Acetyl-CoA C-acyltransferase. [EC: 2.3.1.174, 2.3.1.16]

Predicted SEED Role

"Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)" in subsystem Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 2.3.1.-)

MetaCyc Pathways

• oleate β-oxidation (29/35 steps found)
• fatty acid salvage (6/6 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (5/5 steps found)
• adipate degradation (5/5 steps found)
• 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• ketolysis (3/3 steps found)
• 3-oxoadipate degradation (2/2 steps found)
• adipate biosynthesis (4/5 steps found)
• ketogenesis (4/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (8/11 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• polyhydroxybutanoate biosynthesis (2/3 steps found)
• L-isoleucine degradation I (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• acetoacetate degradation (to acetyl CoA) (1/2 steps found)
• aromatic compounds degradation via β-ketoadipate (6/9 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• ethylmalonyl-CoA pathway (7/11 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• 5,6-dehydrokavain biosynthesis (engineered) (6/10 steps found)
• catechol degradation III (ortho-cleavage pathway) (3/6 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• valproate β-oxidation (5/9 steps found)
• fatty acid β-oxidation VII (yeast peroxisome) (2/5 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• superpathway of salicylate degradation (3/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• phenylacetate degradation I (aerobic) (4/9 steps found)
• glycerol degradation to butanol (9/16 steps found)
• ethylbenzene degradation (anaerobic) (1/5 steps found)
• isopropanol biosynthesis (engineered) (1/5 steps found)
• pyruvate fermentation to acetone (1/5 steps found)
• 2-deoxy-D-ribose degradation II (3/8 steps found)
• pyruvate fermentation to butanol I (3/8 steps found)
• superpathway of phenylethylamine degradation (5/11 steps found)
• acetyl-CoA fermentation to butanoate (2/7 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (2/7 steps found)
• mevalonate pathway II (haloarchaea) (2/7 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
• 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
• 4-ethylphenol degradation (anaerobic) (1/6 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• isoprene biosynthesis II (engineered) (2/8 steps found)
• mevalonate pathway III (Thermoplasma) (2/8 steps found)
• mevalonate pathway IV (archaea) (2/8 steps found)
• methyl tert-butyl ether degradation (3/10 steps found)
• 4-oxopentanoate degradation (2/9 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• L-lysine fermentation to acetate and butanoate (2/10 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (4/13 steps found)
• 10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
• 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
• L-tryptophan degradation III (eukaryotic) (4/15 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
• mandelate degradation to acetyl-CoA (5/18 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (4/17 steps found)
• toluene degradation VI (anaerobic) (4/18 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)
• jasmonic acid biosynthesis (4/19 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
• sitosterol degradation to androstenedione (1/18 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• platensimycin biosynthesis (6/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (12/35 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• superpathway of ergosterol biosynthesis I (4/26 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (18/56 steps found)
• superpathway of L-lysine degradation (8/43 steps found)
• superpathway of cholesterol biosynthesis (4/38 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.16, 2.3.1.174

Use Curated BLAST to search for 2.3.1.- or 2.3.1.16 or 2.3.1.174

Sequence Analysis Tools

See A0A0H3C9X2 at UniProt or InterPro

Protein Sequence (399 amino acids)

>CCNA_02490 3-ketoacyl-CoA thiolase (Caulobacter crescentus NA1000)
MTAAYICDGIRTPIGRYGGSLSKVRADDLAAIPLKALVARNPSLDLAAIDEIVLGSANQA
GEDNRNVARMALLLAGYPVSVPGVTVNRLCASGLEAVGYAARAIASGHNDLVIAGGVESM
SRAPFVMGKADSAFSRSAEIFDTTIGWRFVNPAMRKLYGVDSMPETAENVATDYGVNRED
QDAFALRSQARTAAAQANGFLAGEITPVEIPGKAGPTIVDRDEHPRETTMEALAKLKPIV
REGGTVTAGNASGVNDGAVALVIASEDAVKRHGLTPRARITGYASAGVEPRVMGIGPVPA
VRKLMAKTGLAIGDFDVVELNEAFAAQGLAVLRQLGLPDDGAHVNANGGAIALGHPLGAS
GARLVLTALRQLEASGGQRGLATLCIGVGQGAALAFERV