Protein Info for CCNA_02475 in Caulobacter crescentus NA1000

Annotation: transcriptional regulator vanR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF00392: GntR" amino acids 10 to 67 (58 residues), 51.9 bits, see alignment E=4.7e-18 PF07729: FCD" amino acids 81 to 214 (134 residues), 54.5 bits, see alignment E=1.7e-18

Best Hits

KEGG orthology group: K11475, GntR family transcriptional regulator, vanillate catabolism transcriptional regulator (inferred from 100% identity to ccr:CC_2392)

Predicted SEED Role

"Transcriptional regulator for ferulate or vanillate catabolism" in subsystem Phenylpropanoid compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9V9 at UniProt or InterPro

Protein Sequence (244 amino acids)

>CCNA_02475 transcriptional regulator vanR (Caulobacter crescentus NA1000)
MDMPRIKPGQRVMMALRKMIASGEIKSGERIAEIPTAAALGVSRMPVRTALRSLEQEGLV
VRLGARGYAARGVSSDQIRDAIEVRGVLEGFAARRLAERGMTAETHARFVALIAEGEALF
AAGRLNGEDLDRYAAYNQAFHDTLVSAAGNGAVESALARNGFEPFAAAGALALDLMDLPA
EYEHLLAAHRQHQAVLDAVSCGDAEGAERIMRDHALAAIRNAKVFEAAASAGAPLGAAWS
IRAD