Protein Info for CCNA_02467 in Caulobacter crescentus NA1000
Annotation: polyisoprenylphosphate hexose-1-phosphotransferase pssZ
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to PSS_RHILP: Exopolysaccharide production protein PSS (pss) from Rhizobium leguminosarum bv. phaseoli
KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 100% identity to ccs:CCNA_02467)Predicted SEED Role
"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)
MetaCyc Pathways
- Salmonella enterica serotype O:3,10 O antigen biosynthesis (1/5 steps found)
- Porphyromonas gingivalis O-LPS antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:2 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:4 O antigen biosynthesis (group B1) (1/6 steps found)
- Salmonella enterica serotype O:9 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:9,46 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:8 O antigen biosynthesis (1/8 steps found)
- Salmonella enterica serotype O:9,46,27 O antigen biosynthesis (1/9 steps found)
- succinoglycan biosynthesis (1/14 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.8.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3CAQ7 at UniProt or InterPro
Protein Sequence (217 amino acids)
>CCNA_02467 polyisoprenylphosphate hexose-1-phosphotransferase pssZ (Caulobacter crescentus NA1000) MLIVSNPTAEQRTCAVKASPVAKDPLKRAMDIVVAGGALLFFAPLLLLVAILIKLESPGP VLFRQSRGGLNGQAFTIFKFRSMRCQENGAEVVQAKRDDDRITTIGRFIRKTSIDELPQL LNVLRGDMSIVGPRPHALAHDEHYGALIANYHLRFRTRPGLTGLAQIKGLRGGTSAVDAM AARIDADNEYIERWTLGGDVKILLMTVPHLLMAENAY