Protein Info for CCNA_02467 in Caulobacter crescentus NA1000

Annotation: polyisoprenylphosphate hexose-1-phosphotransferase pssZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 32 to 55 (24 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 24 to 217 (194 residues), 301.6 bits, see alignment E=6.2e-94 PF02397: Bac_transf" amino acids 27 to 211 (185 residues), 214.3 bits, see alignment E=5.1e-68

Best Hits

Swiss-Prot: 51% identical to PSS_RHILP: Exopolysaccharide production protein PSS (pss) from Rhizobium leguminosarum bv. phaseoli

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 100% identity to ccs:CCNA_02467)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAQ7 at UniProt or InterPro

Protein Sequence (217 amino acids)

>CCNA_02467 polyisoprenylphosphate hexose-1-phosphotransferase pssZ (Caulobacter crescentus NA1000)
MLIVSNPTAEQRTCAVKASPVAKDPLKRAMDIVVAGGALLFFAPLLLLVAILIKLESPGP
VLFRQSRGGLNGQAFTIFKFRSMRCQENGAEVVQAKRDDDRITTIGRFIRKTSIDELPQL
LNVLRGDMSIVGPRPHALAHDEHYGALIANYHLRFRTRPGLTGLAQIKGLRGGTSAVDAM
AARIDADNEYIERWTLGGDVKILLMTVPHLLMAENAY